PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G147400.4
Common NameB456_008G147400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 253aa    MW: 27016.5 Da    PI: 10.7102
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G147400.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.14.6e-1485129347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT++E+ l++ + +++G+g+W++I+r +  +Rt+ q+ s+ qky
  Gorai.008G147400.4  85 AWTEDEHRLFLLGLEKYGKGDWRSISRNFVVTRTPTQVASHAQKY 129
                         6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.6177134IPR017930Myb domain
SuperFamilySSF466897.18E-1780135IPR009057Homeodomain-like
SMARTSM007174.5E-1182132IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.2E-1782132IPR006447Myb domain, plants
CDDcd001677.07E-1185130No hitNo description
PfamPF002495.7E-1285129IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-1185128IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MKLATAPSGV ESKIRHLRMP LQHILRTPQI GGRKSRLISS EGSTCHAGDE VTSKKGSDHL  60
GHFNSESDHG SKNSRSDQER RKGIAWTEDE HRLFLLGLEK YGKGDWRSIS RNFVVTRTPT  120
QVASHAQKYF IRLNSINKDR RRSSIHDITS VGNGEILATQ GPITGEPNGA ATGGSSAKSA  180
KQPSQLPAAP PGVGMYSSPT IGQPIGGPLV STVGTPVNLP APPHLAYGAV VPSAPMNMGP  240
VKYSMPHKSD HR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012438079.11e-157PREDICTED: transcription factor DIVARICATA-like
RefseqXP_012438080.11e-157PREDICTED: transcription factor DIVARICATA-like
RefseqXP_012438081.11e-157PREDICTED: transcription factor DIVARICATA-like
RefseqXP_012438082.11e-157PREDICTED: transcription factor DIVARICATA-like
RefseqXP_012438083.11e-157PREDICTED: transcription factor DIVARICATA-like
TrEMBLA0A0D2U3D80.0A0A0D2U3D8_G
STRINGGLYMA07G28310.11e-108(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-80MYB family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]